Resources
Compound reference
Class, sequence and molecular weight for every compound we supply. These are literature reference values. The lot certificate is the authority for a specific vial.
| Compound | Class | Sequence | Molecular weight | Fill |
|---|---|---|---|---|
| BPC-157 | Regulatory peptides | Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (GEPPPGKPADDAGLV) | 1419.5 g/mol | 5mg, 10mg |
| Reta (G3-R) | Incretin analogs | 39-residue modified peptide with non-standard residues and a lipidated lysine; full structure on the certificate | ≈4731 g/mol | 10mg, 30mg |
| Tirz (G2-T) | Incretin analogs | 39-residue GIP-based analog with Aib at positions 2 and 13 and an acylated Lys20 | 4813.5 g/mol | 10mg, 30mg |
| TB-500 | Regulatory peptides | Ac-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES | 4963.4 g/mol | 10mg |
| CJC-1295 No DAC | GHRH-class analogs | Modified GRF(1-29)-NH2: D-Ala2, Gln8, Ala15, Leu27 (YaDAIFTQSYRKVLAQLSARKLLQDILSR-NH2) | ≈3367.9 g/mol | 5mg |
| GHK-Cu | Copper complexes | Gly-His-Lys, complexed with copper(II) | 340.4 g/mol (free GHK); complex value stated on the lot certificate of analysis | 50mg |
| Sema (G1-S) | Incretin analogs | GLP-1(7-37) analog: Aib8, Arg34, acylated Lys26 | 4113.6 g/mol | 5mg, 10mg |
| Ipamorelin | GHRH-class analogs | Aib-His-D-2Nal-D-Phe-Lys-NH2 | 711.9 g/mol | 5mg |
| MOTS-C | Mitochondrial peptides | Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg (MRWQEMGYIFYPRKLR) | 2174.6 g/mol | 10mg |
| Semax | Neuropeptides | Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP) | 813.9 g/mol | 30mg |
| NAD+ | Mitochondrial peptides | Not applicable (dinucleotide coenzyme) | 663.4 g/mol | 500mg |
| KLOW Blend | Regulatory peptides | Multi-compound blend; components listed on the label and certificate | Not applicable (blend) | 80mg |
| Tesamorelin | GHRH-class analogs | trans-3-hexenoyl-hGHRH(1-44)-NH2 | 5135.9 g/mol | 10mg |
| Sermorelin | GHRH-class analogs | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 | 3357.9 g/mol | 5mg |
| CJC-1295 DAC | GHRH-class analogs | Modified GRF(1-29): D-Ala2, Gln8, Ala15, Leu27, Lys30-MPA-NH2 | ≈3647 g/mol | 5mg |
| Cagri (C-AMYLIN) | Incretin analogs | Acylated amylin analog with non-standard residues; full structure on the certificate | ≈4409 g/mol | 5mg |
| Sema / Cagri Blend (G1-S / C-AMYLIN) | Incretin analogs | G1-S: GLP-1(7-37) analog with Aib8, Arg34, acylated Lys26 · C-AMYLIN: acylated amylin analog | Not applicable (blend); ≈4113.6 g/mol and ≈4409 g/mol for the components | 5mg/5mg |
| Thymosin alpha-1 | Regulatory peptides | Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN-OH | 3108.3 g/mol | 10mg |
| KPV | Regulatory peptides | Lys-Pro-Val (KPV) | 342.4 g/mol | 10mg |
| Selank | Neuropeptides | Thr-Lys-Pro-Arg-Pro-Gly-Pro (TKPRPGP) | 751.9 g/mol | 5mg |
| SS-31 | Mitochondrial peptides | D-Arg-Dmt-Lys-Phe-NH2 (Dmt = 2',6'-dimethyltyrosine) | 639.8 g/mol | 10mg |
| Kisspeptin-10 | Neuroendocrine peptides | Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 (YNWNSFGLRF-NH2) | 1302.4 g/mol | 10mg |
| Melanotan II | Neuroendocrine peptides | Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2 | 1024.2 g/mol | 10mg |
| PT-141 | Neuroendocrine peptides | Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH | 1025.2 g/mol | 10mg |
| Oxytocin | Neuroendocrine peptides | Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2 (disulfide Cys1–Cys6) | 1007.2 g/mol | 5mg |
| CJC-1295 No DAC / Ipamorelin Blend | GHRH-class analogs | CJC-1295 No DAC: modified GRF(1-29)-NH2 · Ipamorelin: Aib-His-D-2Nal-D-Phe-Lys-NH2 | Not applicable (blend); ≈3368 g/mol and 711.9 g/mol for the components | 5mg/5mg |
| BPC-157 / TB-500 Blend | Regulatory peptides | BPC-157: GEPPPGKPADDAGLV · TB-500: Ac-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES | Not applicable (blend); 1419.5 g/mol and 4963.4 g/mol for the components | 10mg/10mg, 5mg/5mg |
| DSIP | Neuropeptides | Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu (WAGGDASGE) | 848.8 g/mol | 5mg |
| Epithalon | Regulatory peptides | Ala-Glu-Asp-Gly (AEDG) | 390.3 g/mol | 10mg |
| GLOW Blend | Copper complexes | GHK-Cu: Gly-His-Lys·Cu(II) · BPC-157: GEPPPGKPADDAGLV · TB-500: thymosin beta-4 | Not applicable (blend) | 70mg |
| IGF-1 LR3 | Regulatory peptides | 83-residue recombinant IGF-1 analog (N-terminal extension, Glu3→Arg); full sequence on the certificate | ≈9111 g/mol | 1mg |
See the documents. Every published certificate of analysis is on our Lab Results page. A lot without a published certificate is marked "COA pending".